Anti NEU1 pAb (ATL-HPA021506)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021506-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: NEU1
Alternative Gene Name: NEU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007038: 92%, ENSRNOG00000032942: 91%
Entrez Gene ID: 4758
Uniprot ID: Q99519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNG |
| Gene Sequence | RDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNG |
| Gene ID - Mouse | ENSMUSG00000007038 |
| Gene ID - Rat | ENSRNOG00000032942 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NEU1 pAb (ATL-HPA021506) | |
| Datasheet | Anti NEU1 pAb (ATL-HPA021506) Datasheet (External Link) |
| Vendor Page | Anti NEU1 pAb (ATL-HPA021506) at Atlas Antibodies |
| Documents & Links for Anti NEU1 pAb (ATL-HPA021506) | |
| Datasheet | Anti NEU1 pAb (ATL-HPA021506) Datasheet (External Link) |
| Vendor Page | Anti NEU1 pAb (ATL-HPA021506) |