Anti NEU1 pAb (ATL-HPA021506)

Atlas Antibodies

Catalog No.:
ATL-HPA021506-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: sialidase 1 (lysosomal sialidase)
Gene Name: NEU1
Alternative Gene Name: NEU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007038: 92%, ENSRNOG00000032942: 91%
Entrez Gene ID: 4758
Uniprot ID: Q99519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNG
Gene Sequence RDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNG
Gene ID - Mouse ENSMUSG00000007038
Gene ID - Rat ENSRNOG00000032942
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NEU1 pAb (ATL-HPA021506)
Datasheet Anti NEU1 pAb (ATL-HPA021506) Datasheet (External Link)
Vendor Page Anti NEU1 pAb (ATL-HPA021506) at Atlas Antibodies

Documents & Links for Anti NEU1 pAb (ATL-HPA021506)
Datasheet Anti NEU1 pAb (ATL-HPA021506) Datasheet (External Link)
Vendor Page Anti NEU1 pAb (ATL-HPA021506)