Anti NEO1 pAb (ATL-HPA027806 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA027806-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: neogenin 1
Gene Name: NEO1
Alternative Gene Name: HsT17534, IGDCC2, NGN, NTN1R2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032340: 98%, ENSRNOG00000006490: 98%
Entrez Gene ID: 4756
Uniprot ID: Q92859
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGR
Gene Sequence SVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGR
Gene ID - Mouse ENSMUSG00000032340
Gene ID - Rat ENSRNOG00000006490
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NEO1 pAb (ATL-HPA027806 w/enhanced validation)
Datasheet Anti NEO1 pAb (ATL-HPA027806 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NEO1 pAb (ATL-HPA027806 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NEO1 pAb (ATL-HPA027806 w/enhanced validation)
Datasheet Anti NEO1 pAb (ATL-HPA027806 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NEO1 pAb (ATL-HPA027806 w/enhanced validation)
Citations for Anti NEO1 pAb (ATL-HPA027806 w/enhanced validation) – 1 Found
Yin, Kai; Wang, Linjun; Xia, Yiwen; Dang, Shengchun; Zhang, Xuan; He, Zhongyuan; Xu, Jianghao; Shang, Mengyuan; Xu, Zekuan. Netrin-1 promotes cell neural invasion in gastric cancer via its receptor neogenin. Journal Of Cancer. 10(14):3197-3207.  PubMed