Anti NEO1 pAb (ATL-HPA027806 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027806-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: NEO1
Alternative Gene Name: HsT17534, IGDCC2, NGN, NTN1R2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032340: 98%, ENSRNOG00000006490: 98%
Entrez Gene ID: 4756
Uniprot ID: Q92859
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGR |
| Gene Sequence | SVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGR |
| Gene ID - Mouse | ENSMUSG00000032340 |
| Gene ID - Rat | ENSRNOG00000006490 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NEO1 pAb (ATL-HPA027806 w/enhanced validation) | |
| Datasheet | Anti NEO1 pAb (ATL-HPA027806 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NEO1 pAb (ATL-HPA027806 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti NEO1 pAb (ATL-HPA027806 w/enhanced validation) | |
| Datasheet | Anti NEO1 pAb (ATL-HPA027806 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NEO1 pAb (ATL-HPA027806 w/enhanced validation) |
| Citations for Anti NEO1 pAb (ATL-HPA027806 w/enhanced validation) – 1 Found |
| Yin, Kai; Wang, Linjun; Xia, Yiwen; Dang, Shengchun; Zhang, Xuan; He, Zhongyuan; Xu, Jianghao; Shang, Mengyuan; Xu, Zekuan. Netrin-1 promotes cell neural invasion in gastric cancer via its receptor neogenin. Journal Of Cancer. 10(14):3197-3207. PubMed |