Anti NEK7 pAb (ATL-HPA018193)

Atlas Antibodies

Catalog No.:
ATL-HPA018193-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: NIMA-related kinase 7
Gene Name: NEK7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072919: 29%, ENSRNOG00000061713: 27%
Entrez Gene ID: 140609
Uniprot ID: Q8TDX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VCLLPVWERRVCALNACYFLEIIKGSESLQYMATLTNLFENLPVSHHGSFA
Gene Sequence VCLLPVWERRVCALNACYFLEIIKGSESLQYMATLTNLFENLPVSHHGSFA
Gene ID - Mouse ENSMUSG00000072919
Gene ID - Rat ENSRNOG00000061713
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NEK7 pAb (ATL-HPA018193)
Datasheet Anti NEK7 pAb (ATL-HPA018193) Datasheet (External Link)
Vendor Page Anti NEK7 pAb (ATL-HPA018193) at Atlas Antibodies

Documents & Links for Anti NEK7 pAb (ATL-HPA018193)
Datasheet Anti NEK7 pAb (ATL-HPA018193) Datasheet (External Link)
Vendor Page Anti NEK7 pAb (ATL-HPA018193)