Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041399-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NEK5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037738: 49%, ENSRNOG00000048769: 49%
Entrez Gene ID: 341676
Uniprot ID: Q6P3R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FQELPFRKNEMKEQEYWKQLEEIRQQYHNDMKEIRKKMGREPEENSKISHKTYLVKKSNLPVHQDASEGEAPVQ |
| Gene Sequence | FQELPFRKNEMKEQEYWKQLEEIRQQYHNDMKEIRKKMGREPEENSKISHKTYLVKKSNLPVHQDASEGEAPVQ |
| Gene ID - Mouse | ENSMUSG00000037738 |
| Gene ID - Rat | ENSRNOG00000048769 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation) | |
| Datasheet | Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation) | |
| Datasheet | Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation) |
| Citations for Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation) – 1 Found |
| de Castro Ferezin, Camila; Lim Kam Sian, Terry C C; Wu, Yunjian; Ma, Xiuquan; Chüeh, Anderly C; Huang, Cheng; Schittenhelm, Ralf B; Kobarg, Jörg; Daly, Roger J. Identification of biological pathways and processes regulated by NEK5 in breast epithelial cells via an integrated proteomic approach. Cell Communication And Signaling : Ccs. 2022;20(1):197. PubMed |