Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA041399-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: NIMA-related kinase 5
Gene Name: NEK5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037738: 49%, ENSRNOG00000048769: 49%
Entrez Gene ID: 341676
Uniprot ID: Q6P3R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FQELPFRKNEMKEQEYWKQLEEIRQQYHNDMKEIRKKMGREPEENSKISHKTYLVKKSNLPVHQDASEGEAPVQ
Gene Sequence FQELPFRKNEMKEQEYWKQLEEIRQQYHNDMKEIRKKMGREPEENSKISHKTYLVKKSNLPVHQDASEGEAPVQ
Gene ID - Mouse ENSMUSG00000037738
Gene ID - Rat ENSRNOG00000048769
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation)
Datasheet Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation)
Datasheet Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation)
Citations for Anti NEK5 pAb (ATL-HPA041399 w/enhanced validation) – 1 Found
de Castro Ferezin, Camila; Lim Kam Sian, Terry C C; Wu, Yunjian; Ma, Xiuquan; Chüeh, Anderly C; Huang, Cheng; Schittenhelm, Ralf B; Kobarg, Jörg; Daly, Roger J. Identification of biological pathways and processes regulated by NEK5 in breast epithelial cells via an integrated proteomic approach. Cell Communication And Signaling : Ccs. 2022;20(1):197.  PubMed