Anti NEK5 pAb (ATL-HPA035565 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035565-25

Protein Description: NIMA-related kinase 5
Gene Name: NEK5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037738: 57%, ENSRNOG00000048769: 59%
Entrez Gene ID: 341676
Uniprot ID: Q6P3R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETLTFEDGMKFKEYECVKEHGDYTDKAFEKLHCPEAGFSTQTVAAVGNRRQWDGGAPQTLLQMMAVADITSTCPTGPDSESVLSVSRQEG
• Gene Sequence: ETLTFEDGMKFKEYECVKEHGDYTDKAFEKLHCPEAGFSTQTVAAVGNRRQWDGGAPQTLLQMMAVADITSTCPTGPDSESVLSVSRQEG
• Gene ID - Mouse: ENSMUSG00000037738
• Gene ID - Rat: ENSRNOG00000048769
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NEK5 pAb (ATL-HPA035565 w/enhanced validation) – 2 Found

Melo-Hanchuk, Talita Diniz; Martins, Mariana Bonjiorno; Cunha, Lucas Leite; Soares, Fernando Augusto; Ward, Laura Sterian; Vassallo, José; Kobarg, Jörg. Expression of the NEK family in normal and cancer tissue: an immunohistochemical study. Bmc Cancer. 2020;20(1):23. 

Ferezin, Camila de Castro; Basei, Fernanda Luisa; Melo-Hanchuk, Talita D; de Oliveira, Ana Luisa; Peres de Oliveira, Andressa; Mori, Mateus P; de Souza-Pinto, Nadja C; Kobarg, Jörg. NEK5 interacts with LonP1 and its kinase activity is essential for the regulation of mitochondrial functions and mtDNA maintenance. Febs Open Bio. 2021;11(3):546-563.