Anti NEK11 pAb (ATL-HPA016908)

Atlas Antibodies

Catalog No.:
ATL-HPA016908-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: NIMA-related kinase 11
Gene Name: NEK11
Alternative Gene Name: FLJ23495
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035032: 84%, ENSRNOG00000042432: 82%
Entrez Gene ID: 79858
Uniprot ID: Q8NG66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMC
Gene Sequence DFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMC
Gene ID - Mouse ENSMUSG00000035032
Gene ID - Rat ENSRNOG00000042432
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NEK11 pAb (ATL-HPA016908)
Datasheet Anti NEK11 pAb (ATL-HPA016908) Datasheet (External Link)
Vendor Page Anti NEK11 pAb (ATL-HPA016908) at Atlas Antibodies

Documents & Links for Anti NEK11 pAb (ATL-HPA016908)
Datasheet Anti NEK11 pAb (ATL-HPA016908) Datasheet (External Link)
Vendor Page Anti NEK11 pAb (ATL-HPA016908)
Citations for Anti NEK11 pAb (ATL-HPA016908) – 1 Found
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.  PubMed