Anti NEFM pAb (ATL-HPA023138 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA023138-25
  • Immunohistochemistry analysis in human cerebral cortex and endometrium tissues using HPA023138 antibody. Corresponding NEFM RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to intermediate filaments.
  • Western blot analysis in human cell line HEK 293 and human cell line A-431.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: neurofilament, medium polypeptide
Gene Name: NEFM
Alternative Gene Name: NEF3, NF-M, NFM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022054: 98%, ENSRNOG00000013916: 98%
Entrez Gene ID: 4741
Uniprot ID: P07197
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH
Gene Sequence YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH
Gene ID - Mouse ENSMUSG00000022054
Gene ID - Rat ENSRNOG00000013916
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NEFM pAb (ATL-HPA023138 w/enhanced validation)
Datasheet Anti NEFM pAb (ATL-HPA023138 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NEFM pAb (ATL-HPA023138 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NEFM pAb (ATL-HPA023138 w/enhanced validation)
Datasheet Anti NEFM pAb (ATL-HPA023138 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NEFM pAb (ATL-HPA023138 w/enhanced validation)