Anti NEDD8 pAb (ATL-HPA027583)

Atlas Antibodies

Catalog No.:
ATL-HPA027583-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: neural precursor cell expressed, developmentally down-regulated 8
Gene Name: NEDD8
Alternative Gene Name: Nedd-8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010376: 100%, ENSRNOG00000019895: 100%
Entrez Gene ID: 4738
Uniprot ID: Q15843
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL
Gene Sequence TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL
Gene ID - Mouse ENSMUSG00000010376
Gene ID - Rat ENSRNOG00000019895
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NEDD8 pAb (ATL-HPA027583)
Datasheet Anti NEDD8 pAb (ATL-HPA027583) Datasheet (External Link)
Vendor Page Anti NEDD8 pAb (ATL-HPA027583) at Atlas Antibodies

Documents & Links for Anti NEDD8 pAb (ATL-HPA027583)
Datasheet Anti NEDD8 pAb (ATL-HPA027583) Datasheet (External Link)
Vendor Page Anti NEDD8 pAb (ATL-HPA027583)