Anti NEDD8 pAb (ATL-HPA027583)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027583-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: NEDD8
Alternative Gene Name: Nedd-8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010376: 100%, ENSRNOG00000019895: 100%
Entrez Gene ID: 4738
Uniprot ID: Q15843
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL |
| Gene Sequence | TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL |
| Gene ID - Mouse | ENSMUSG00000010376 |
| Gene ID - Rat | ENSRNOG00000019895 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NEDD8 pAb (ATL-HPA027583) | |
| Datasheet | Anti NEDD8 pAb (ATL-HPA027583) Datasheet (External Link) |
| Vendor Page | Anti NEDD8 pAb (ATL-HPA027583) at Atlas Antibodies |
| Documents & Links for Anti NEDD8 pAb (ATL-HPA027583) | |
| Datasheet | Anti NEDD8 pAb (ATL-HPA027583) Datasheet (External Link) |
| Vendor Page | Anti NEDD8 pAb (ATL-HPA027583) |