Anti NECTIN3 pAb (ATL-HPA011038)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011038-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NECTIN3
Alternative Gene Name: CD113, CDw113, DKFZP566B0846, nectin-3, PPR3, PVRL3, PVRR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022656: 95%, ENSRNOG00000002176: 95%
Entrez Gene ID: 25945
Uniprot ID: Q9NQS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWEGDLGEMESTTTSF |
| Gene Sequence | IHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWEGDLGEMESTTTSF |
| Gene ID - Mouse | ENSMUSG00000022656 |
| Gene ID - Rat | ENSRNOG00000002176 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NECTIN3 pAb (ATL-HPA011038) | |
| Datasheet | Anti NECTIN3 pAb (ATL-HPA011038) Datasheet (External Link) |
| Vendor Page | Anti NECTIN3 pAb (ATL-HPA011038) at Atlas Antibodies |
| Documents & Links for Anti NECTIN3 pAb (ATL-HPA011038) | |
| Datasheet | Anti NECTIN3 pAb (ATL-HPA011038) Datasheet (External Link) |
| Vendor Page | Anti NECTIN3 pAb (ATL-HPA011038) |
| Citations for Anti NECTIN3 pAb (ATL-HPA011038) – 2 Found |
| Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
| Haeberle, Henry; Dudley, Joel T; Liu, Jonathan T C; Butte, Atul J; Contag, Christopher H. Identification of cell surface targets through meta-analysis of microarray data. Neoplasia (New York, N.y.). 2012;14(7):666-9. PubMed |