Anti NECTIN3 pAb (ATL-HPA011038)

Atlas Antibodies

Catalog No.:
ATL-HPA011038-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: nectin cell adhesion molecule 3
Gene Name: NECTIN3
Alternative Gene Name: CD113, CDw113, DKFZP566B0846, nectin-3, PPR3, PVRL3, PVRR3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022656: 95%, ENSRNOG00000002176: 95%
Entrez Gene ID: 25945
Uniprot ID: Q9NQS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWEGDLGEMESTTTSF
Gene Sequence IHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWEGDLGEMESTTTSF
Gene ID - Mouse ENSMUSG00000022656
Gene ID - Rat ENSRNOG00000002176
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NECTIN3 pAb (ATL-HPA011038)
Datasheet Anti NECTIN3 pAb (ATL-HPA011038) Datasheet (External Link)
Vendor Page Anti NECTIN3 pAb (ATL-HPA011038) at Atlas Antibodies

Documents & Links for Anti NECTIN3 pAb (ATL-HPA011038)
Datasheet Anti NECTIN3 pAb (ATL-HPA011038) Datasheet (External Link)
Vendor Page Anti NECTIN3 pAb (ATL-HPA011038)
Citations for Anti NECTIN3 pAb (ATL-HPA011038) – 2 Found
Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300.  PubMed
Haeberle, Henry; Dudley, Joel T; Liu, Jonathan T C; Butte, Atul J; Contag, Christopher H. Identification of cell surface targets through meta-analysis of microarray data. Neoplasia (New York, N.y.). 2012;14(7):666-9.  PubMed