Anti NDUFV1 pAb (ATL-HPA075051)

Atlas Antibodies

Catalog No.:
ATL-HPA075051-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
Gene Name: NDUFV1
Alternative Gene Name: CI-51K
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037916: 100%, ENSRNOG00000018117: 100%
Entrez Gene ID: 4723
Uniprot ID: P49821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence DFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNH
Gene ID - Mouse ENSMUSG00000037916
Gene ID - Rat ENSMUSG00000037916
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDUFV1 pAb (ATL-HPA075051)
Datasheet Anti NDUFV1 pAb (ATL-HPA075051) Datasheet (External Link)
Vendor Page Anti NDUFV1 pAb (ATL-HPA075051) at Atlas Antibodies

Documents & Links for Anti NDUFV1 pAb (ATL-HPA075051)
Datasheet Anti NDUFV1 pAb (ATL-HPA075051) Datasheet (External Link)
Vendor Page Anti NDUFV1 pAb (ATL-HPA075051)