Anti NDUFS8 pAb (ATL-HPA018524)

Atlas Antibodies

Catalog No.:
ATL-HPA018524-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase)
Gene Name: NDUFS8
Alternative Gene Name: CI-23k, TYKY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059734: 91%, ENSRNOG00000017446: 92%
Entrez Gene ID: 4728
Uniprot ID: O00217
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYC
Gene Sequence AATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYC
Gene ID - Mouse ENSMUSG00000059734
Gene ID - Rat ENSRNOG00000017446
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDUFS8 pAb (ATL-HPA018524)
Datasheet Anti NDUFS8 pAb (ATL-HPA018524) Datasheet (External Link)
Vendor Page Anti NDUFS8 pAb (ATL-HPA018524) at Atlas Antibodies

Documents & Links for Anti NDUFS8 pAb (ATL-HPA018524)
Datasheet Anti NDUFS8 pAb (ATL-HPA018524) Datasheet (External Link)
Vendor Page Anti NDUFS8 pAb (ATL-HPA018524)