Anti NDUFS8 pAb (ATL-HPA018524)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018524-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NDUFS8
Alternative Gene Name: CI-23k, TYKY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059734: 91%, ENSRNOG00000017446: 92%
Entrez Gene ID: 4728
Uniprot ID: O00217
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYC |
| Gene Sequence | AATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYC |
| Gene ID - Mouse | ENSMUSG00000059734 |
| Gene ID - Rat | ENSRNOG00000017446 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NDUFS8 pAb (ATL-HPA018524) | |
| Datasheet | Anti NDUFS8 pAb (ATL-HPA018524) Datasheet (External Link) |
| Vendor Page | Anti NDUFS8 pAb (ATL-HPA018524) at Atlas Antibodies |
| Documents & Links for Anti NDUFS8 pAb (ATL-HPA018524) | |
| Datasheet | Anti NDUFS8 pAb (ATL-HPA018524) Datasheet (External Link) |
| Vendor Page | Anti NDUFS8 pAb (ATL-HPA018524) |