Anti NDUFB8 pAb (ATL-HPA003886)

Atlas Antibodies

Catalog No.: ATL-HPA003886-25

Protein Description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa
Gene Name: NDUFB8
Alternative Gene Name: ASHI, CI-ASHI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025204: 84%, ENSRNOG00000014078: 86%
Entrez Gene ID: 4714
Uniprot ID: O95169
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDM
• Gene Sequence: GARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDM
• Gene ID - Mouse: ENSMUSG00000025204
• Gene ID - Rat: ENSRNOG00000014078
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NDUFB8 pAb (ATL-HPA003886) – 3 Found

Rhein, Virginie F; Carroll, Joe; Ding, Shujing; Fearnley, Ian M; Walker, John E. NDUFAF5 Hydroxylates NDUFS7 at an Early Stage in the Assembly of Human Complex I. The Journal Of Biological Chemistry. 2016;291(28):14851-60. 

Ni, Yang; Hagras, Muhammad A; Konstantopoulou, Vassiliki; Mayr, Johannes A; Stuchebrukhov, Alexei A; Meierhofer, David. Mutations in NDUFS1 Cause Metabolic Reprogramming and Disruption of the Electron Transfer. Cells. 2019;8(10) 

Chung, I-Che; Chen, Lih-Chyang; Tsang, Ngan-Ming; Chuang, Wen-Yu; Liao, Tzu-Chieh; Yuan, Sheng-Ning; OuYang, Chun-Nan; Ojcius, David M; Wu, Chih-Ching; Chang, Yu-Sun. Mitochondrial Oxidative Phosphorylation Complex Regulates NLRP3 Inflammasome Activation and Predicts Patient Survival in Nasopharyngeal Carcinoma. Molecular & Cellular Proteomics : Mcp. 2020;19(1):142-154.