Anti NDUFB7 pAb (ATL-HPA002817)

Atlas Antibodies

Catalog No.:
ATL-HPA002817-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
Gene Name: NDUFB7
Alternative Gene Name: B18, CI-B18, MGC2480
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033938: 84%, ENSRNOG00000028717: 79%
Entrez Gene ID: 4713
Uniprot ID: P17568
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen FPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKV
Gene Sequence FPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKV
Gene ID - Mouse ENSMUSG00000033938
Gene ID - Rat ENSRNOG00000028717
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDUFB7 pAb (ATL-HPA002817)
Datasheet Anti NDUFB7 pAb (ATL-HPA002817) Datasheet (External Link)
Vendor Page Anti NDUFB7 pAb (ATL-HPA002817) at Atlas Antibodies

Documents & Links for Anti NDUFB7 pAb (ATL-HPA002817)
Datasheet Anti NDUFB7 pAb (ATL-HPA002817) Datasheet (External Link)
Vendor Page Anti NDUFB7 pAb (ATL-HPA002817)