Anti NDUFAF4 pAb (ATL-HPA046560)

Atlas Antibodies

Catalog No.: ATL-HPA046560-25

Protein Description: NADH dehydrogenase (ubiquinone) complex I, assembly factor 4
Gene Name: NDUFAF4
Alternative Gene Name: bA22L21.1, C6orf66, HRPAP20, HSPC125, My013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028261: 83%, ENSRNOG00000007506: 83%
Entrez Gene ID: 29078
Uniprot ID: Q9P032
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK
• Gene Sequence: IKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK
• Gene ID - Mouse: ENSMUSG00000028261
• Gene ID - Rat: ENSRNOG00000007506
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.