Anti NDUFAF4 pAb (ATL-HPA046560)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046560-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NDUFAF4
Alternative Gene Name: bA22L21.1, C6orf66, HRPAP20, HSPC125, My013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028261: 83%, ENSRNOG00000007506: 83%
Entrez Gene ID: 29078
Uniprot ID: Q9P032
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK |
Gene Sequence | IKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK |
Gene ID - Mouse | ENSMUSG00000028261 |
Gene ID - Rat | ENSRNOG00000007506 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NDUFAF4 pAb (ATL-HPA046560) | |
Datasheet | Anti NDUFAF4 pAb (ATL-HPA046560) Datasheet (External Link) |
Vendor Page | Anti NDUFAF4 pAb (ATL-HPA046560) at Atlas Antibodies |
Documents & Links for Anti NDUFAF4 pAb (ATL-HPA046560) | |
Datasheet | Anti NDUFAF4 pAb (ATL-HPA046560) Datasheet (External Link) |
Vendor Page | Anti NDUFAF4 pAb (ATL-HPA046560) |