Anti NDUFA3 pAb (ATL-HPA046976)

Atlas Antibodies

Catalog No.:
ATL-HPA046976-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa
Gene Name: NDUFA3
Alternative Gene Name: B9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035674: 88%, ENSRNOG00000060293: 83%
Entrez Gene ID: 4696
Uniprot ID: O95167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL
Gene Sequence PYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL
Gene ID - Mouse ENSMUSG00000035674
Gene ID - Rat ENSRNOG00000060293
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDUFA3 pAb (ATL-HPA046976)
Datasheet Anti NDUFA3 pAb (ATL-HPA046976) Datasheet (External Link)
Vendor Page Anti NDUFA3 pAb (ATL-HPA046976) at Atlas Antibodies

Documents & Links for Anti NDUFA3 pAb (ATL-HPA046976)
Datasheet Anti NDUFA3 pAb (ATL-HPA046976) Datasheet (External Link)
Vendor Page Anti NDUFA3 pAb (ATL-HPA046976)