Anti NDUFA3 pAb (ATL-HPA046976)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046976-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NDUFA3
Alternative Gene Name: B9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035674: 88%, ENSRNOG00000060293: 83%
Entrez Gene ID: 4696
Uniprot ID: O95167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL |
Gene Sequence | PYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL |
Gene ID - Mouse | ENSMUSG00000035674 |
Gene ID - Rat | ENSRNOG00000060293 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NDUFA3 pAb (ATL-HPA046976) | |
Datasheet | Anti NDUFA3 pAb (ATL-HPA046976) Datasheet (External Link) |
Vendor Page | Anti NDUFA3 pAb (ATL-HPA046976) at Atlas Antibodies |
Documents & Links for Anti NDUFA3 pAb (ATL-HPA046976) | |
Datasheet | Anti NDUFA3 pAb (ATL-HPA046976) Datasheet (External Link) |
Vendor Page | Anti NDUFA3 pAb (ATL-HPA046976) |