Anti NDUFA2 pAb (ATL-HPA035933)

Atlas Antibodies

Catalog No.:
ATL-HPA035933-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa
Gene Name: NDUFA2
Alternative Gene Name: B8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014294: 85%, ENSRNOG00000017571: 85%
Entrez Gene ID: 4695
Uniprot ID: O43678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGK
Gene Sequence RGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGK
Gene ID - Mouse ENSMUSG00000014294
Gene ID - Rat ENSRNOG00000017571
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NDUFA2 pAb (ATL-HPA035933)
Datasheet Anti NDUFA2 pAb (ATL-HPA035933) Datasheet (External Link)
Vendor Page Anti NDUFA2 pAb (ATL-HPA035933) at Atlas Antibodies

Documents & Links for Anti NDUFA2 pAb (ATL-HPA035933)
Datasheet Anti NDUFA2 pAb (ATL-HPA035933) Datasheet (External Link)
Vendor Page Anti NDUFA2 pAb (ATL-HPA035933)