Anti NDUFA2 pAb (ATL-HPA035933)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035933-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: NDUFA2
Alternative Gene Name: B8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014294: 85%, ENSRNOG00000017571: 85%
Entrez Gene ID: 4695
Uniprot ID: O43678
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGK |
| Gene Sequence | RGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGK |
| Gene ID - Mouse | ENSMUSG00000014294 |
| Gene ID - Rat | ENSRNOG00000017571 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NDUFA2 pAb (ATL-HPA035933) | |
| Datasheet | Anti NDUFA2 pAb (ATL-HPA035933) Datasheet (External Link) |
| Vendor Page | Anti NDUFA2 pAb (ATL-HPA035933) at Atlas Antibodies |
| Documents & Links for Anti NDUFA2 pAb (ATL-HPA035933) | |
| Datasheet | Anti NDUFA2 pAb (ATL-HPA035933) Datasheet (External Link) |
| Vendor Page | Anti NDUFA2 pAb (ATL-HPA035933) |