Anti NDRG2 pAb (ATL-HPA002896 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002896-25

Protein Description: NDRG family member 2
Gene Name: NDRG2
Alternative Gene Name: KIAA1248, SYLD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004558: 94%, ENSRNOG00000010389: 94%
Entrez Gene ID: 57447
Uniprot ID: Q9UN36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQP
• Gene Sequence: TGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQP
• Gene ID - Mouse: ENSMUSG00000004558
• Gene ID - Rat: ENSRNOG00000010389
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NDRG2 pAb (ATL-HPA002896 w/enhanced validation) – 10 Found

Kloten, Vera; Schlensog, Martin; Eschenbruch, Julian; Gasthaus, Janina; Tiedemann, Janina; Mijnes, Jolein; Heide, Timon; Braunschweig, Till; Knüchel, Ruth; Dahl, Edgar. Abundant NDRG2 Expression Is Associated with Aggressiveness and Unfavorable Patients' Outcome in Basal-Like Breast Cancer. Plos One. 11(7):e0159073. 

Mir, Bilal A; Islam, Rabia; Kalanon, Ming; Russell, Aaron P; Foletta, Victoria C. MicroRNA suppression of stress-responsive NDRG2 during dexamethasone treatment in skeletal muscle cells. Bmc Molecular And Cell Biology. 2019;20(1):12. 

Kronschläger, Mira T; Siegert, Anna S M; Resch, Felix J; Rajendran, Pradeep S; Khakh, Baljit S; Sandkühler, Jürgen. Lamina-specific properties of spinal astrocytes. Glia. 2021;69(7):1749-1766. 

Tepel, Martin; Roerig, Peter; Wolter, Marietta; Gutmann, David H; Perry, Arie; Reifenberger, Guido; Riemenschneider, Markus J. Frequent promoter hypermethylation and transcriptional downregulation of the NDRG2 gene at 14q11.2 in primary glioblastoma. International Journal Of Cancer. 2008;123(9):2080-6. 

Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22. 

Schilling, Stephen H; Hjelmeland, Anita B; Radiloff, Daniel R; Liu, Irwin M; Wakeman, Timothy P; Fielhauer, Jeffrey R; Foster, Erika H; Lathia, Justin D; Rich, Jeremy N; Wang, Xiao-Fan; Datto, Michael B. NDRG4 is required for cell cycle progression and survival in glioblastoma cells. The Journal Of Biological Chemistry. 2009;284(37):25160-9. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Anderson, Kimberley J; Russell, Aaron P; Foletta, Victoria C. NDRG2 promotes myoblast proliferation and caspase 3/7 activities during differentiation, and attenuates hydrogen peroxide - But not palmitate-induced toxicity. Febs Open Bio. 5( 26380811):668-81. 

Xu, Jinying; Ji, Tong; Li, Guichen; Zhang, Haiying; Zheng, Yangyang; Li, Meiying; Ma, Jie; Li, Yulin; Chi, Guangfan. Lactate attenuates astrocytic inflammation by inhibiting ubiquitination and degradation of NDRG2 under oxygen-glucose deprivation conditions. Journal Of Neuroinflammation. 2022;19(1):314. 

Shively, Sharon Baughman; Edwards, Nancy A; MacDonald, Tobey J; Johnson, Kory R; Diaz-Rodriguez, Natalia M; Merrill, Marsha J; Vortmeyer, Alexander O. Developmentally Arrested Basket/Stellate Cells in Postnatal Human Brain as Potential Tumor Cells of Origin for Cerebellar Hemangioblastoma in von Hippel-Lindau Patients. Journal Of Neuropathology And Experimental Neurology. 2022;81(11):885-899.