Anti NCOA6 pAb (ATL-HPA004198 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA004198-25
  • Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA004198 antibody. Corresponding NCOA6 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: nuclear receptor coactivator 6
Gene Name: NCOA6
Alternative Gene Name: AIB3, ASC2, KIAA0181, NRC, PRIP, RAP250, TRBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038369: 94%, ENSRNOG00000018288: 92%
Entrez Gene ID: 23054
Uniprot ID: Q14686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NQNVQHAGGQGAGPPQNQMQVSHGPPNMMQPSLMGIHGNMNNQQAGTSGVPQVNLSNMQGQPQQGPPSQLMGMHQQIVPSQGQMVQQQGTLNPQNPMILSRAQLMPQGQMMVNPPSQNLGPSPQRMTPPKQ
Gene Sequence NQNVQHAGGQGAGPPQNQMQVSHGPPNMMQPSLMGIHGNMNNQQAGTSGVPQVNLSNMQGQPQQGPPSQLMGMHQQIVPSQGQMVQQQGTLNPQNPMILSRAQLMPQGQMMVNPPSQNLGPSPQRMTPPKQ
Gene ID - Mouse ENSMUSG00000038369
Gene ID - Rat ENSRNOG00000018288
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NCOA6 pAb (ATL-HPA004198 w/enhanced validation)
Datasheet Anti NCOA6 pAb (ATL-HPA004198 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NCOA6 pAb (ATL-HPA004198 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti NCOA6 pAb (ATL-HPA004198 w/enhanced validation)
Datasheet Anti NCOA6 pAb (ATL-HPA004198 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti NCOA6 pAb (ATL-HPA004198 w/enhanced validation)



Citations for Anti NCOA6 pAb (ATL-HPA004198 w/enhanced validation) – 1 Found
Tong, Zhangwei; Liu, Yonghong; Yu, Xiaobin; Martinez, Jarrod D; Xu, Jianming. The transcriptional co-activator NCOA6 promotes estrogen-induced GREB1 transcription by recruiting ERα and enhancing enhancer-promoter interactions. The Journal Of Biological Chemistry. 2019;294(51):19667-19682.  PubMed