Anti NCMAP pAb (ATL-HPA013656)

Atlas Antibodies

Catalog No.: ATL-HPA013656-25

Protein Description: noncompact myelin associated protein
Gene Name: NCMAP
Alternative Gene Name: C1orf130, FLJ42528, MP11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043924: 72%, ENSRNOG00000048139: 72%
Entrez Gene ID: 400746
Uniprot ID: Q5T1S8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YNRKMRTRRELEPKGPKPTAPSAVGPNSNGSQHPATVTFSPVDVQVE
• Gene Sequence: YNRKMRTRRELEPKGPKPTAPSAVGPNSNGSQHPATVTFSPVDVQVE
• Gene ID - Mouse: ENSMUSG00000043924
• Gene ID - Rat: ENSRNOG00000048139
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.