Anti NCKAP5L pAb (ATL-HPA041034)

Atlas Antibodies

Catalog No.: ATL-HPA041034-25

Protein Description: NCK-associated protein 5-like
Gene Name: NCKAP5L
Alternative Gene Name: KIAA1602
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023009: 92%, ENSRNOG00000056678: 90%
Entrez Gene ID: 57701
Uniprot ID: Q9HCH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEKVMKGIEENVLRLQGQERAPGAEVKHRNTSSIASWFGLKKSKLPALNRRTEATKNKEGAGGGSPLRREVKMEARKL
• Gene Sequence: EEKVMKGIEENVLRLQGQERAPGAEVKHRNTSSIASWFGLKKSKLPALNRRTEATKNKEGAGGGSPLRREVKMEARKL
• Gene ID - Mouse: ENSMUSG00000023009
• Gene ID - Rat: ENSRNOG00000056678
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.