Anti NCKAP5 pAb (ATL-HPA044859)

Atlas Antibodies

Catalog No.:
ATL-HPA044859-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: NCK-associated protein 5
Gene Name: NCKAP5
Alternative Gene Name: ERIH1, ERIH2, NAP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049690: 61%, ENSRNOG00000021553: 61%
Entrez Gene ID: 344148
Uniprot ID: O14513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PELQCETENELIKDTKSADNPDGGLQSKNNRRTPQDIYNQLKIEPRNRHSPVACSTKDTFMTELLNRVDKKAAPQTESGSSNASCRNVLKGSSQ
Gene Sequence PELQCETENELIKDTKSADNPDGGLQSKNNRRTPQDIYNQLKIEPRNRHSPVACSTKDTFMTELLNRVDKKAAPQTESGSSNASCRNVLKGSSQ
Gene ID - Mouse ENSMUSG00000049690
Gene ID - Rat ENSRNOG00000021553
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NCKAP5 pAb (ATL-HPA044859)
Datasheet Anti NCKAP5 pAb (ATL-HPA044859) Datasheet (External Link)
Vendor Page Anti NCKAP5 pAb (ATL-HPA044859) at Atlas Antibodies

Documents & Links for Anti NCKAP5 pAb (ATL-HPA044859)
Datasheet Anti NCKAP5 pAb (ATL-HPA044859) Datasheet (External Link)
Vendor Page Anti NCKAP5 pAb (ATL-HPA044859)