Anti NCKAP5 pAb (ATL-HPA034639)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034639-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NCKAP5
Alternative Gene Name: ERIH1, ERIH2, NAP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049690: 68%, ENSRNOG00000021553: 70%
Entrez Gene ID: 344148
Uniprot ID: O14513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SKLTHSVSDSLFGWETNRKHFLEGTSSVYPKERPEKLTSCASSCPLEMKLCPSVQTPQVQRERGPQGQGHGRMALNLQLSD |
| Gene Sequence | SKLTHSVSDSLFGWETNRKHFLEGTSSVYPKERPEKLTSCASSCPLEMKLCPSVQTPQVQRERGPQGQGHGRMALNLQLSD |
| Gene ID - Mouse | ENSMUSG00000049690 |
| Gene ID - Rat | ENSRNOG00000021553 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NCKAP5 pAb (ATL-HPA034639) | |
| Datasheet | Anti NCKAP5 pAb (ATL-HPA034639) Datasheet (External Link) |
| Vendor Page | Anti NCKAP5 pAb (ATL-HPA034639) at Atlas Antibodies |
| Documents & Links for Anti NCKAP5 pAb (ATL-HPA034639) | |
| Datasheet | Anti NCKAP5 pAb (ATL-HPA034639) Datasheet (External Link) |
| Vendor Page | Anti NCKAP5 pAb (ATL-HPA034639) |