Anti NCKAP5 pAb (ATL-HPA034639)

Atlas Antibodies

Catalog No.: ATL-HPA034639-25

Protein Description: NCK-associated protein 5
Gene Name: NCKAP5
Alternative Gene Name: ERIH1, ERIH2, NAP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049690: 68%, ENSRNOG00000021553: 70%
Entrez Gene ID: 344148
Uniprot ID: O14513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKLTHSVSDSLFGWETNRKHFLEGTSSVYPKERPEKLTSCASSCPLEMKLCPSVQTPQVQRERGPQGQGHGRMALNLQLSD
• Gene Sequence: SKLTHSVSDSLFGWETNRKHFLEGTSSVYPKERPEKLTSCASSCPLEMKLCPSVQTPQVQRERGPQGQGHGRMALNLQLSD
• Gene ID - Mouse: ENSMUSG00000049690
• Gene ID - Rat: ENSRNOG00000021553
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.