Anti NCKAP1L pAb (ATL-HPA040772)

Atlas Antibodies

Catalog No.:
ATL-HPA040772-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: NCK-associated protein 1-like
Gene Name: NCKAP1L
Alternative Gene Name: HEM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022488: 92%, ENSRNOG00000036829: 92%
Entrez Gene ID: 3071
Uniprot ID: P55160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSIFELASAAGVGCDIDPALVAAIANLKADTSSPEE
Gene Sequence FRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSIFELASAAGVGCDIDPALVAAIANLKADTSSPEE
Gene ID - Mouse ENSMUSG00000022488
Gene ID - Rat ENSRNOG00000036829
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NCKAP1L pAb (ATL-HPA040772)
Datasheet Anti NCKAP1L pAb (ATL-HPA040772) Datasheet (External Link)
Vendor Page Anti NCKAP1L pAb (ATL-HPA040772) at Atlas Antibodies

Documents & Links for Anti NCKAP1L pAb (ATL-HPA040772)
Datasheet Anti NCKAP1L pAb (ATL-HPA040772) Datasheet (External Link)
Vendor Page Anti NCKAP1L pAb (ATL-HPA040772)