Anti NCKAP1L pAb (ATL-HPA040772)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040772-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NCKAP1L
Alternative Gene Name: HEM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022488: 92%, ENSRNOG00000036829: 92%
Entrez Gene ID: 3071
Uniprot ID: P55160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSIFELASAAGVGCDIDPALVAAIANLKADTSSPEE |
Gene Sequence | FRAMAQEGLREVFSSHCPFLMGPIECLKEFVTPDTDIKVTLSIFELASAAGVGCDIDPALVAAIANLKADTSSPEE |
Gene ID - Mouse | ENSMUSG00000022488 |
Gene ID - Rat | ENSRNOG00000036829 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NCKAP1L pAb (ATL-HPA040772) | |
Datasheet | Anti NCKAP1L pAb (ATL-HPA040772) Datasheet (External Link) |
Vendor Page | Anti NCKAP1L pAb (ATL-HPA040772) at Atlas Antibodies |
Documents & Links for Anti NCKAP1L pAb (ATL-HPA040772) | |
Datasheet | Anti NCKAP1L pAb (ATL-HPA040772) Datasheet (External Link) |
Vendor Page | Anti NCKAP1L pAb (ATL-HPA040772) |