Anti NCKAP1L pAb (ATL-HPA039490)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039490-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NCKAP1L
Alternative Gene Name: HEM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022488: 96%, ENSRNOG00000036829: 97%
Entrez Gene ID: 3071
Uniprot ID: P55160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VLIRMYNIKKTCSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVD |
| Gene Sequence | VLIRMYNIKKTCSDPKSKPPFLLEKSMEPSLKYINKKFPNIDVRNSTQHLGPVHREKAEIIRFLTNYYQSFVD |
| Gene ID - Mouse | ENSMUSG00000022488 |
| Gene ID - Rat | ENSRNOG00000036829 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NCKAP1L pAb (ATL-HPA039490) | |
| Datasheet | Anti NCKAP1L pAb (ATL-HPA039490) Datasheet (External Link) |
| Vendor Page | Anti NCKAP1L pAb (ATL-HPA039490) at Atlas Antibodies |
| Documents & Links for Anti NCKAP1L pAb (ATL-HPA039490) | |
| Datasheet | Anti NCKAP1L pAb (ATL-HPA039490) Datasheet (External Link) |
| Vendor Page | Anti NCKAP1L pAb (ATL-HPA039490) |
| Citations for Anti NCKAP1L pAb (ATL-HPA039490) – 1 Found |
| Huang, Youjin; Ren, Li; Li, Jiajia; Zou, Haibo. Long non-coding RNA PVT1/microRNA miR-3127-5p/NCK-associated protein 1-like axis participates in the pathogenesis of abdominal aortic aneurysm by regulating vascular smooth muscle cells. Bioengineered. 2021;12(2):12583-12596. PubMed |