Anti NCF4 pAb (ATL-HPA036156)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036156-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: NCF4
Alternative Gene Name: p40phox, SH3PXD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071715: 95%, ENSRNOG00000006940: 97%
Entrez Gene ID: 4689
Uniprot ID: Q15080
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRY |
| Gene Sequence | MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRY |
| Gene ID - Mouse | ENSMUSG00000071715 |
| Gene ID - Rat | ENSRNOG00000006940 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NCF4 pAb (ATL-HPA036156) | |
| Datasheet | Anti NCF4 pAb (ATL-HPA036156) Datasheet (External Link) |
| Vendor Page | Anti NCF4 pAb (ATL-HPA036156) at Atlas Antibodies |
| Documents & Links for Anti NCF4 pAb (ATL-HPA036156) | |
| Datasheet | Anti NCF4 pAb (ATL-HPA036156) Datasheet (External Link) |
| Vendor Page | Anti NCF4 pAb (ATL-HPA036156) |