Anti NCEH1 pAb (ATL-HPA026888 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026888-25

Protein Description: neutral cholesterol ester hydrolase 1
Gene Name: NCEH1
Alternative Gene Name: AADACL1, KIAA1363, NCEH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027698: 83%, ENSRNOG00000013313: 83%
Entrez Gene ID: 57552
Uniprot ID: Q6PIU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVL
• Gene Sequence: ALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVL
• Gene ID - Mouse: ENSMUSG00000027698
• Gene ID - Rat: ENSRNOG00000013313
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NCEH1 pAb (ATL-HPA026888 w/enhanced validation) – 1 Found

Mei, Shuang; Gu, Haihua; Ward, Adam; Yang, Xuefeng; Guo, Huailan; He, Ka; Liu, Zhenqi; Cao, Wenhong. p38 mitogen-activated protein kinase (MAPK) promotes cholesterol ester accumulation in macrophages through inhibition of macroautophagy. The Journal Of Biological Chemistry. 2012;287(15):11761-8.