Anti NCAPH pAb (ATL-HPA003008 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003008-25

Protein Description: non-SMC condensin I complex, subunit H
Gene Name: NCAPH
Alternative Gene Name: BRRN1, CAP-H, hCAP-H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034906: 81%, ENSRNOG00000012051: 84%
Entrez Gene ID: 23397
Uniprot ID: Q15003
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KFTNTQITEHYSTCIKLSTENKITTKNAFGLHLIDFMSEILKQKDTEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDAPSLEEVEGHVADGSATEMGTTKKAVKPKKKHLHRTIEQNINNLNVSEADRKCEI
• Gene Sequence: KFTNTQITEHYSTCIKLSTENKITTKNAFGLHLIDFMSEILKQKDTEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDAPSLEEVEGHVADGSATEMGTTKKAVKPKKKHLHRTIEQNINNLNVSEADRKCEI
• Gene ID - Mouse: ENSMUSG00000034906
• Gene ID - Rat: ENSRNOG00000012051
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NCAPH pAb (ATL-HPA003008 w/enhanced validation) – 3 Found

Yokoyama, Yuhki; Zhu, Hengrui; Zhang, Rugang; Noma, Ken-ichi. A novel role for the condensin II complex in cellular senescence. Cell Cycle (Georgetown, Tex.). 14(13):2160-70. 

Zhan, Shi-Jie; Liu, Bin; Linghu, Hua. Identifying genes as potential prognostic indicators in patients with serous ovarian cancer resistant to carboplatin using integrated bioinformatics analysis. Oncology Reports. 2018;39(6):2653-2663. 

Dávalos, Verónica; Súarez-López, Lucía; Castaño, Julio; Messent, Anthea; Abasolo, Ibane; Fernandez, Yolanda; Guerra-Moreno, Angel; Espín, Eloy; Armengol, Manel; Musulen, Eva; Ariza, Aurelio; Sayós, Joan; Arango, Diego; Schwartz, Simó Jr. Human SMC2 protein, a core subunit of human condensin complex, is a novel transcriptional target of the WNT signaling pathway and a new therapeutic target. The Journal Of Biological Chemistry. 2012;287(52):43472-81.