Anti NCAPH pAb (ATL-HPA002647 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002647-25

Protein Description: non-SMC condensin I complex, subunit H
Gene Name: NCAPH
Alternative Gene Name: BRRN1, CAP-H, hCAP-H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034906: 80%, ENSRNOG00000012051: 82%
Entrez Gene ID: 23397
Uniprot ID: Q15003
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHCQDYRSELLFPSDVQTLSTGEPLELPELGCVEMTDLKAPLQQCAEDRQICPSLAGFQFTQWDSETHNESVSALVDKFKKNDQVFDINAEVDESDCGDFPDGSLGDDFDANDEPDHT
• Gene Sequence: LHCQDYRSELLFPSDVQTLSTGEPLELPELGCVEMTDLKAPLQQCAEDRQICPSLAGFQFTQWDSETHNESVSALVDKFKKNDQVFDINAEVDESDCGDFPDGSLGDDFDANDEPDHT
• Gene ID - Mouse: ENSMUSG00000034906
• Gene ID - Rat: ENSRNOG00000012051
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NCAPH pAb (ATL-HPA002647 w/enhanced validation) – 3 Found

Scott, Nichollas E; Rogers, Lindsay D; Prudova, Anna; Brown, Nat F; Fortelny, Nikolaus; Overall, Christopher M; Foster, Leonard J. Interactome disassembly during apoptosis occurs independent of caspase cleavage. Molecular Systems Biology. 2017;13(1):906. 

Zhan, Shi-Jie; Liu, Bin; Linghu, Hua. Identifying genes as potential prognostic indicators in patients with serous ovarian cancer resistant to carboplatin using integrated bioinformatics analysis. Oncology Reports. 2018;39(6):2653-2663. 

Meijering, Anna E C; Sarlós, Kata; Nielsen, Christian F; Witt, Hannes; Harju, Janni; Kerklingh, Emma; Haasnoot, Guus H; Bizard, Anna H; Heller, Iddo; Broedersz, Chase P; Liu, Ying; Peterman, Erwin J G; Hickson, Ian D; Wuite, Gijs J L. Nonlinear mechanics of human mitotic chromosomes. Nature. 2022;605(7910):545-550.