Anti NCAPD2 pAb (ATL-HPA037363)

Atlas Antibodies

Catalog No.:
ATL-HPA037363-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: non-SMC condensin I complex, subunit D2
Gene Name: NCAPD2
Alternative Gene Name: CAP-D2, CNAP1, hCAP-D2, KIAA0159
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038252: 90%, ENSRNOG00000055300: 92%
Entrez Gene ID: 9918
Uniprot ID: Q15021
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGTIQCLEEILCEFVQKDELKPAVTQLLWERATEKVACCPLERCSSVMLLGMMARGKPEIVGSNLDTLVSIGLDEKFPQDYRLAQQVCHAIANISDRRKPSLGKRH
Gene Sequence VGTIQCLEEILCEFVQKDELKPAVTQLLWERATEKVACCPLERCSSVMLLGMMARGKPEIVGSNLDTLVSIGLDEKFPQDYRLAQQVCHAIANISDRRKPSLGKRH
Gene ID - Mouse ENSMUSG00000038252
Gene ID - Rat ENSRNOG00000055300
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NCAPD2 pAb (ATL-HPA037363)
Datasheet Anti NCAPD2 pAb (ATL-HPA037363) Datasheet (External Link)
Vendor Page Anti NCAPD2 pAb (ATL-HPA037363) at Atlas Antibodies

Documents & Links for Anti NCAPD2 pAb (ATL-HPA037363)
Datasheet Anti NCAPD2 pAb (ATL-HPA037363) Datasheet (External Link)
Vendor Page Anti NCAPD2 pAb (ATL-HPA037363)