Anti NCAPD2 pAb (ATL-HPA037363)

Atlas Antibodies

Catalog No.: ATL-HPA037363-100

Protein Description: non-SMC condensin I complex, subunit D2
Gene Name: NCAPD2
Alternative Gene Name: CAP-D2, CNAP1, hCAP-D2, KIAA0159
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038252: 90%, ENSRNOG00000055300: 92%
Entrez Gene ID: 9918
Uniprot ID: Q15021
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGTIQCLEEILCEFVQKDELKPAVTQLLWERATEKVACCPLERCSSVMLLGMMARGKPEIVGSNLDTLVSIGLDEKFPQDYRLAQQVCHAIANISDRRKPSLGKRH
• Gene Sequence: VGTIQCLEEILCEFVQKDELKPAVTQLLWERATEKVACCPLERCSSVMLLGMMARGKPEIVGSNLDTLVSIGLDEKFPQDYRLAQQVCHAIANISDRRKPSLGKRH
• Gene ID - Mouse: ENSMUSG00000038252
• Gene ID - Rat: ENSRNOG00000055300
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.