Anti NCAPD2 pAb (ATL-HPA036947)

Atlas Antibodies

Catalog No.: ATL-HPA036947-25

Protein Description: non-SMC condensin I complex, subunit D2
Gene Name: NCAPD2
Alternative Gene Name: CAP-D2, CNAP1, hCAP-D2, KIAA0159
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038252: 87%, ENSRNOG00000055300: 88%
Entrez Gene ID: 9918
Uniprot ID: Q15021
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKSVLVCKNAIQLLASFLANNPFSCKLSDADLAGPLQKETQKLQEMRAQRRTAAASAVLDPEEEWEAMLPELKSTLQQLLQLPQGEEEIPEQIA
• Gene Sequence: DKSVLVCKNAIQLLASFLANNPFSCKLSDADLAGPLQKETQKLQEMRAQRRTAAASAVLDPEEEWEAMLPELKSTLQQLLQLPQGEEEIPEQIA
• Gene ID - Mouse: ENSMUSG00000038252
• Gene ID - Rat: ENSRNOG00000055300
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NCAPD2 pAb (ATL-HPA036947) – 2 Found

Eykelenboom, John K; Gierliński, Marek; Yue, Zuojun; Hegarat, Nadia; Pollard, Hilary; Fukagawa, Tatsuo; Hochegger, Helfrid; Tanaka, Tomoyuki U. Live imaging of marked chromosome regions reveals their dynamic resolution and compaction in mitosis. The Journal Of Cell Biology. 2019;218(5):1531-1552. 

Sharp, Judith A; Perea-Resa, Carlos; Wang, Wei; Blower, Michael D. Cell division requires RNA eviction from condensing chromosomes. The Journal Of Cell Biology. 2020;219(11)