Anti NCAM2 pAb (ATL-HPA030901)

Atlas Antibodies

Catalog No.:
ATL-HPA030901-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: neural cell adhesion molecule 2
Gene Name: NCAM2
Alternative Gene Name: MGC51008, NCAM21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022762: 100%, ENSRNOG00000002126: 100%
Entrez Gene ID: 4685
Uniprot ID: O15394
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGS
Gene Sequence VSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGS
Gene ID - Mouse ENSMUSG00000022762
Gene ID - Rat ENSRNOG00000002126
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NCAM2 pAb (ATL-HPA030901)
Datasheet Anti NCAM2 pAb (ATL-HPA030901) Datasheet (External Link)
Vendor Page Anti NCAM2 pAb (ATL-HPA030901) at Atlas Antibodies

Documents & Links for Anti NCAM2 pAb (ATL-HPA030901)
Datasheet Anti NCAM2 pAb (ATL-HPA030901) Datasheet (External Link)
Vendor Page Anti NCAM2 pAb (ATL-HPA030901)