Anti NCAM2 pAb (ATL-HPA030901)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030901-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NCAM2
Alternative Gene Name: MGC51008, NCAM21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022762: 100%, ENSRNOG00000002126: 100%
Entrez Gene ID: 4685
Uniprot ID: O15394
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGS |
| Gene Sequence | VSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGS |
| Gene ID - Mouse | ENSMUSG00000022762 |
| Gene ID - Rat | ENSRNOG00000002126 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NCAM2 pAb (ATL-HPA030901) | |
| Datasheet | Anti NCAM2 pAb (ATL-HPA030901) Datasheet (External Link) |
| Vendor Page | Anti NCAM2 pAb (ATL-HPA030901) at Atlas Antibodies |
| Documents & Links for Anti NCAM2 pAb (ATL-HPA030901) | |
| Datasheet | Anti NCAM2 pAb (ATL-HPA030901) Datasheet (External Link) |
| Vendor Page | Anti NCAM2 pAb (ATL-HPA030901) |