Anti NBPF6 pAb (ATL-HPA047447)

Atlas Antibodies

Catalog No.:
ATL-HPA047447-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: neuroblastoma breakpoint family, member 6
Gene Name: NBPF6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039703: 27%, ENSRNOG00000012728: 30%
Entrez Gene ID: 653149
Uniprot ID: Q5VWK0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KQSDLEEVKGQETVAPRLSRGPLRVDKHEIPQESLDGCCLTPSILPDLTPSYHPYWSTLYSFEDKQVSLALVDK
Gene Sequence KQSDLEEVKGQETVAPRLSRGPLRVDKHEIPQESLDGCCLTPSILPDLTPSYHPYWSTLYSFEDKQVSLALVDK
Gene ID - Mouse ENSMUSG00000039703
Gene ID - Rat ENSRNOG00000012728
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NBPF6 pAb (ATL-HPA047447)
Datasheet Anti NBPF6 pAb (ATL-HPA047447) Datasheet (External Link)
Vendor Page Anti NBPF6 pAb (ATL-HPA047447) at Atlas Antibodies

Documents & Links for Anti NBPF6 pAb (ATL-HPA047447)
Datasheet Anti NBPF6 pAb (ATL-HPA047447) Datasheet (External Link)
Vendor Page Anti NBPF6 pAb (ATL-HPA047447)