Anti NBPF4 pAb (ATL-HPA046411)

Atlas Antibodies

SKU:
ATL-HPA046411-25
  • Immunohistochemical staining of human testis shows moderate positivity in cells in seminiferous ducts.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: neuroblastoma breakpoint family, member 4
Gene Name: NBPF4
Alternative Gene Name: FLJ32833
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031227: 39%, ENSRNOG00000020601: 38%
Entrez Gene ID: 148545
Uniprot ID: Q96M43
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGKAPVPPRHHDKSNSYRHREVSFLALDEQKV
Gene Sequence EGKAPVPPRHHDKSNSYRHREVSFLALDEQKV
Gene ID - Mouse ENSMUSG00000031227
Gene ID - Rat ENSRNOG00000020601
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NBPF4 pAb (ATL-HPA046411)
Datasheet Anti NBPF4 pAb (ATL-HPA046411) Datasheet (External Link)
Vendor Page Anti NBPF4 pAb (ATL-HPA046411) at Atlas Antibodies

Documents & Links for Anti NBPF4 pAb (ATL-HPA046411)
Datasheet Anti NBPF4 pAb (ATL-HPA046411) Datasheet (External Link)
Vendor Page Anti NBPF4 pAb (ATL-HPA046411)