Anti NBPF3 pAb (ATL-HPA046971)

Atlas Antibodies

Catalog No.: ATL-HPA046971-100

Protein Description: neuroblastoma breakpoint family member 3
Gene Name: NBPF3
Alternative Gene Name: AE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050600: 41%, ENSRNOG00000018434: 43%
Entrez Gene ID: 84224
Uniprot ID: Q9H094
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RELLDEKEPEVLQDSLDRCYSTPSGYLELP
• Gene Sequence: RELLDEKEPEVLQDSLDRCYSTPSGYLELP
• Gene ID - Mouse: ENSMUSG00000050600
• Gene ID - Rat: ENSRNOG00000018434
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.