Anti NBN pAb (ATL-HPA001429)

Atlas Antibodies

Catalog No.: ATL-HPA001429-25

Protein Description: nibrin
Gene Name: NBN
Alternative Gene Name: AT-V1, AT-V2, ATV, NBS, NBS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028224: 65%, ENSRNOG00000008580: 65%
Entrez Gene ID: 4683
Uniprot ID: O60934
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDL
• Gene Sequence: DTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDL
• Gene ID - Mouse: ENSMUSG00000028224
• Gene ID - Rat: ENSRNOG00000008580
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NBN pAb (ATL-HPA001429) – 2 Found

Seidel, Philipp; Remus, Martina; Delacher, Michael; Grigaravicius, Paulius; Reuss, David E; Frappart, Lucien; von Deimling, Andreas; Feuerer, Markus; Abdollahi, Amir; Frappart, Pierre-Olivier. Epidermal Nbn deletion causes premature hair loss and a phenotype resembling psoriasiform dermatitis. Oncotarget. 2016;7(17):23006-18. 

Alblihy, Adel; Ali, Reem; Algethami, Mashael; Shoqafi, Ahmed; Toss, Michael S; Brownlie, Juliette; Tatum, Natalie J; Hickson, Ian; Moran, Paloma Ordonez; Grabowska, Anna; Jeyapalan, Jennie N; Mongan, Nigel P; Rakha, Emad A; Madhusudan, Srinivasan. Targeting Mre11 overcomes platinum resistance and induces synthetic lethality in XRCC1 deficient epithelial ovarian cancers. Npj Precision Oncology. 2022;6(1):51.