Anti NAT6 pAb (ATL-HPA039576)

Atlas Antibodies

Catalog No.: ATL-HPA039576-25

Protein Description: N-acetyltransferase 6 (GCN5-related)
Gene Name: NAT6
Alternative Gene Name: FUS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079334: 86%, ENSRNOG00000054063: 87%
Entrez Gene ID: 24142
Uniprot ID: Q93015
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLN
• Gene Sequence: PSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLN
• Gene ID - Mouse: ENSMUSG00000079334
• Gene ID - Rat: ENSRNOG00000054063
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.