Anti NARS pAb (ATL-HPA040017)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040017-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NARS
Alternative Gene Name: NARS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024587: 91%, ENSRNOG00000017852: 88%
Entrez Gene ID: 4677
Uniprot ID: O43776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIK |
| Gene Sequence | RLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIK |
| Gene ID - Mouse | ENSMUSG00000024587 |
| Gene ID - Rat | ENSRNOG00000017852 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NARS pAb (ATL-HPA040017) | |
| Datasheet | Anti NARS pAb (ATL-HPA040017) Datasheet (External Link) |
| Vendor Page | Anti NARS pAb (ATL-HPA040017) at Atlas Antibodies |
| Documents & Links for Anti NARS pAb (ATL-HPA040017) | |
| Datasheet | Anti NARS pAb (ATL-HPA040017) Datasheet (External Link) |
| Vendor Page | Anti NARS pAb (ATL-HPA040017) |