Anti NARS pAb (ATL-HPA040017)

Atlas Antibodies

Catalog No.:
ATL-HPA040017-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: asparaginyl-tRNA synthetase
Gene Name: NARS
Alternative Gene Name: NARS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024587: 91%, ENSRNOG00000017852: 88%
Entrez Gene ID: 4677
Uniprot ID: O43776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen RLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIK
Gene Sequence RLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIK
Gene ID - Mouse ENSMUSG00000024587
Gene ID - Rat ENSRNOG00000017852
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NARS pAb (ATL-HPA040017)
Datasheet Anti NARS pAb (ATL-HPA040017) Datasheet (External Link)
Vendor Page Anti NARS pAb (ATL-HPA040017) at Atlas Antibodies

Documents & Links for Anti NARS pAb (ATL-HPA040017)
Datasheet Anti NARS pAb (ATL-HPA040017) Datasheet (External Link)
Vendor Page Anti NARS pAb (ATL-HPA040017)