Anti NARS pAb (ATL-HPA040017)

Atlas Antibodies

Catalog No.: ATL-HPA040017-25

Protein Description: asparaginyl-tRNA synthetase
Gene Name: NARS
Alternative Gene Name: NARS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024587: 91%, ENSRNOG00000017852: 88%
Entrez Gene ID: 4677
Uniprot ID: O43776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIK
• Gene Sequence: RLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIK
• Gene ID - Mouse: ENSMUSG00000024587
• Gene ID - Rat: ENSRNOG00000017852
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.