Anti NARFL pAb (ATL-HPA040851)

Atlas Antibodies

Catalog No.: ATL-HPA040851-25

Protein Description: nuclear prelamin A recognition factor-like
Gene Name: NARFL
Alternative Gene Name: FLJ21988, HPRN, IOP1, PRN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002280: 89%, ENSRNOG00000019522: 87%
Entrez Gene ID: 64428
Uniprot ID: Q9H6Q4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLEASRPDFFNQEHQTRDVDCVLTTGEVFRLLEEEGVSLPDLEPAPLDSLCSGASAEEPTSHRGGGSGGYLEHVFRHAARELFGIHVAEVTYKP
• Gene Sequence: KLEASRPDFFNQEHQTRDVDCVLTTGEVFRLLEEEGVSLPDLEPAPLDSLCSGASAEEPTSHRGGGSGGYLEHVFRHAARELFGIHVAEVTYKP
• Gene ID - Mouse: ENSMUSG00000002280
• Gene ID - Rat: ENSRNOG00000019522
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NARFL pAb (ATL-HPA040851) – 2 Found

Ferecatu, Ioana; Canal, Frédéric; Fabbri, Lucilla; Mazure, Nathalie M; Bouton, Cécile; Golinelli-Cohen, Marie-Pierre. Dysfunction in the mitochondrial Fe-S assembly machinery leads to formation of the chemoresistant truncated VDAC1 isoform without HIF-1α activation. Plos One. 13(3):e0194782. 

Ferecatu, Ioana; Gonçalves, Sergio; Golinelli-Cohen, Marie-Pierre; Clémancey, Martin; Martelli, Alain; Riquier, Sylvie; Guittet, Eric; Latour, Jean-Marc; Puccio, Hélène; Drapier, Jean-Claude; Lescop, Ewen; Bouton, Cécile. The diabetes drug target MitoNEET governs a novel trafficking pathway to rebuild an Fe-S cluster into cytosolic aconitase/iron regulatory protein 1. The Journal Of Biological Chemistry. 2014;289(41):28070-86.