Anti NAPA pAb (ATL-HPA046149)

Atlas Antibodies

Catalog No.:
ATL-HPA046149-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: N-ethylmaleimide-sensitive factor attachment protein, alpha
Gene Name: NAPA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006024: 100%, ENSRNOG00000001494: 100%
Entrez Gene ID: 8775
Uniprot ID: P54920
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IEEACEIYARAANMFKMAKNWSAAGNAFCQAAQLHLQLQSKHD
Gene Sequence IEEACEIYARAANMFKMAKNWSAAGNAFCQAAQLHLQLQSKHD
Gene ID - Mouse ENSMUSG00000006024
Gene ID - Rat ENSRNOG00000001494
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NAPA pAb (ATL-HPA046149)
Datasheet Anti NAPA pAb (ATL-HPA046149) Datasheet (External Link)
Vendor Page Anti NAPA pAb (ATL-HPA046149) at Atlas Antibodies

Documents & Links for Anti NAPA pAb (ATL-HPA046149)
Datasheet Anti NAPA pAb (ATL-HPA046149) Datasheet (External Link)
Vendor Page Anti NAPA pAb (ATL-HPA046149)