Anti NAP1L6 pAb (ATL-HPA044957)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044957-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NAP1L6
Alternative Gene Name: FLJ33596
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000082229: 46%, ENSRNOG00000007808: 41%
Entrez Gene ID:
Uniprot ID: A6NFF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MMEGLGEHSTAGEMGPLLGAVAATASPQSLMEYSSDADFIESLPLVVKYRVYTLKKLQAKCAVLEAKYLREFHSVE |
| Gene Sequence | MMEGLGEHSTAGEMGPLLGAVAATASPQSLMEYSSDADFIESLPLVVKYRVYTLKKLQAKCAVLEAKYLREFHSVE |
| Gene ID - Mouse | ENSMUSG00000082229 |
| Gene ID - Rat | ENSRNOG00000007808 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NAP1L6 pAb (ATL-HPA044957) | |
| Datasheet | Anti NAP1L6 pAb (ATL-HPA044957) Datasheet (External Link) |
| Vendor Page | Anti NAP1L6 pAb (ATL-HPA044957) at Atlas Antibodies |
| Documents & Links for Anti NAP1L6 pAb (ATL-HPA044957) | |
| Datasheet | Anti NAP1L6 pAb (ATL-HPA044957) Datasheet (External Link) |
| Vendor Page | Anti NAP1L6 pAb (ATL-HPA044957) |