Anti NAP1L6 pAb (ATL-HPA044957)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044957-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NAP1L6
Alternative Gene Name: FLJ33596
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000082229: 46%, ENSRNOG00000007808: 41%
Entrez Gene ID:
Uniprot ID: A6NFF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MMEGLGEHSTAGEMGPLLGAVAATASPQSLMEYSSDADFIESLPLVVKYRVYTLKKLQAKCAVLEAKYLREFHSVE |
Gene Sequence | MMEGLGEHSTAGEMGPLLGAVAATASPQSLMEYSSDADFIESLPLVVKYRVYTLKKLQAKCAVLEAKYLREFHSVE |
Gene ID - Mouse | ENSMUSG00000082229 |
Gene ID - Rat | ENSRNOG00000007808 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NAP1L6 pAb (ATL-HPA044957) | |
Datasheet | Anti NAP1L6 pAb (ATL-HPA044957) Datasheet (External Link) |
Vendor Page | Anti NAP1L6 pAb (ATL-HPA044957) at Atlas Antibodies |
Documents & Links for Anti NAP1L6 pAb (ATL-HPA044957) | |
Datasheet | Anti NAP1L6 pAb (ATL-HPA044957) Datasheet (External Link) |
Vendor Page | Anti NAP1L6 pAb (ATL-HPA044957) |