Anti NAP1L6 pAb (ATL-HPA044957)

Atlas Antibodies

Catalog No.:
ATL-HPA044957-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nucleosome assembly protein 1-like 6
Gene Name: NAP1L6
Alternative Gene Name: FLJ33596
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000082229: 46%, ENSRNOG00000007808: 41%
Entrez Gene ID:
Uniprot ID: A6NFF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MMEGLGEHSTAGEMGPLLGAVAATASPQSLMEYSSDADFIESLPLVVKYRVYTLKKLQAKCAVLEAKYLREFHSVE
Gene Sequence MMEGLGEHSTAGEMGPLLGAVAATASPQSLMEYSSDADFIESLPLVVKYRVYTLKKLQAKCAVLEAKYLREFHSVE
Gene ID - Mouse ENSMUSG00000082229
Gene ID - Rat ENSRNOG00000007808
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NAP1L6 pAb (ATL-HPA044957)
Datasheet Anti NAP1L6 pAb (ATL-HPA044957) Datasheet (External Link)
Vendor Page Anti NAP1L6 pAb (ATL-HPA044957) at Atlas Antibodies

Documents & Links for Anti NAP1L6 pAb (ATL-HPA044957)
Datasheet Anti NAP1L6 pAb (ATL-HPA044957) Datasheet (External Link)
Vendor Page Anti NAP1L6 pAb (ATL-HPA044957)