Anti NAF1 pAb (ATL-HPA036241)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036241-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NAF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014907: 89%, ENSRNOG00000026403: 90%
Entrez Gene ID: 92345
Uniprot ID: Q96HR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SSCISLPPVLSDGDDDLQVEKENKNFPLKTKDELLLNELPSVEELTIILPEDIELKPLGMVSSIIEQLVIIESMTNLPPVNEETVIFKSDRQAAGKIF |
| Gene Sequence | SSCISLPPVLSDGDDDLQVEKENKNFPLKTKDELLLNELPSVEELTIILPEDIELKPLGMVSSIIEQLVIIESMTNLPPVNEETVIFKSDRQAAGKIF |
| Gene ID - Mouse | ENSMUSG00000014907 |
| Gene ID - Rat | ENSRNOG00000026403 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NAF1 pAb (ATL-HPA036241) | |
| Datasheet | Anti NAF1 pAb (ATL-HPA036241) Datasheet (External Link) |
| Vendor Page | Anti NAF1 pAb (ATL-HPA036241) at Atlas Antibodies |
| Documents & Links for Anti NAF1 pAb (ATL-HPA036241) | |
| Datasheet | Anti NAF1 pAb (ATL-HPA036241) Datasheet (External Link) |
| Vendor Page | Anti NAF1 pAb (ATL-HPA036241) |