Anti NACC2 pAb (ATL-HPA047924)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047924-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NACC2
Alternative Gene Name: BEND9, BTBD14A, BTBD31, MGC23427
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026932: 88%, ENSRNOG00000018231: 88%
Entrez Gene ID: 138151
Uniprot ID: Q96BF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RVRKRWLPKIKSMLPEGVEMYRTVMGSAAASVPLDPEFPPAAAQVFEQRIYAERRGDAATIVALRTDAVNVDLSAAAN |
| Gene Sequence | RVRKRWLPKIKSMLPEGVEMYRTVMGSAAASVPLDPEFPPAAAQVFEQRIYAERRGDAATIVALRTDAVNVDLSAAAN |
| Gene ID - Mouse | ENSMUSG00000026932 |
| Gene ID - Rat | ENSRNOG00000018231 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NACC2 pAb (ATL-HPA047924) | |
| Datasheet | Anti NACC2 pAb (ATL-HPA047924) Datasheet (External Link) |
| Vendor Page | Anti NACC2 pAb (ATL-HPA047924) at Atlas Antibodies |
| Documents & Links for Anti NACC2 pAb (ATL-HPA047924) | |
| Datasheet | Anti NACC2 pAb (ATL-HPA047924) Datasheet (External Link) |
| Vendor Page | Anti NACC2 pAb (ATL-HPA047924) |