Anti N4BP1 pAb (ATL-HPA040849)

Atlas Antibodies

Catalog No.:
ATL-HPA040849-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: NEDD4 binding protein 1
Gene Name: N4BP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031652: 68%, ENSRNOG00000015121: 67%
Entrez Gene ID: 9683
Uniprot ID: O75113
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NELTTDSTPKKTQAHTQQNMVEKFSQLPFKVEAKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPSVASPSPKEVNFVSRGASSHQPR
Gene Sequence NELTTDSTPKKTQAHTQQNMVEKFSQLPFKVEAKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPSVASPSPKEVNFVSRGASSHQPR
Gene ID - Mouse ENSMUSG00000031652
Gene ID - Rat ENSRNOG00000015121
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti N4BP1 pAb (ATL-HPA040849)
Datasheet Anti N4BP1 pAb (ATL-HPA040849) Datasheet (External Link)
Vendor Page Anti N4BP1 pAb (ATL-HPA040849) at Atlas Antibodies

Documents & Links for Anti N4BP1 pAb (ATL-HPA040849)
Datasheet Anti N4BP1 pAb (ATL-HPA040849) Datasheet (External Link)
Vendor Page Anti N4BP1 pAb (ATL-HPA040849)