Anti MYOM3 pAb (ATL-HPA028340)

Atlas Antibodies

Catalog No.:
ATL-HPA028340-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: myomesin 3
Gene Name: MYOM3
Alternative Gene Name: FLJ35961
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037139: 89%, ENSRNOG00000032994: 88%
Entrez Gene ID: 127294
Uniprot ID: Q5VTT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDDSILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKD
Gene Sequence EDDSILDLTGDALDAIFTELGRIGALSATPLKIQGTEEGIRIFSKVKYYNVEYMKTTWFHKDKRLESGDRIRTGTTLDEIWLHILDPKD
Gene ID - Mouse ENSMUSG00000037139
Gene ID - Rat ENSRNOG00000032994
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MYOM3 pAb (ATL-HPA028340)
Datasheet Anti MYOM3 pAb (ATL-HPA028340) Datasheet (External Link)
Vendor Page Anti MYOM3 pAb (ATL-HPA028340) at Atlas Antibodies

Documents & Links for Anti MYOM3 pAb (ATL-HPA028340)
Datasheet Anti MYOM3 pAb (ATL-HPA028340) Datasheet (External Link)
Vendor Page Anti MYOM3 pAb (ATL-HPA028340)