Anti MYOF pAb (ATL-HPA014245 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA014245-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: myoferlin
Gene Name: MYOF
Alternative Gene Name: FER1L3, KIAA1207
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048612: 86%, ENSRNOG00000016117: 82%
Entrez Gene ID: 26509
Uniprot ID: Q9NZM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen TIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVV
Gene Sequence TIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVV
Gene ID - Mouse ENSMUSG00000048612
Gene ID - Rat ENSRNOG00000016117
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MYOF pAb (ATL-HPA014245 w/enhanced validation)
Datasheet Anti MYOF pAb (ATL-HPA014245 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MYOF pAb (ATL-HPA014245 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MYOF pAb (ATL-HPA014245 w/enhanced validation)
Datasheet Anti MYOF pAb (ATL-HPA014245 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MYOF pAb (ATL-HPA014245 w/enhanced validation)
Citations for Anti MYOF pAb (ATL-HPA014245 w/enhanced validation) – 13 Found
Blomme, Arnaud; Fahmy, Karim; Peulen, Olivier; Costanza, Brunella; Fontaine, Marie; Struman, Ingrid; Baiwir, Dominique; de Pauw, Edwin; Thiry, Marc; Bellahcène, Akeila; Castronovo, Vincent; Turtoi, Andrei. Myoferlin is a novel exosomal protein and functional regulator of cancer-derived exosomes. Oncotarget. 2016;7(50):83669-83683.  PubMed
Yadav, A; Kumar, B; Lang, J C; Teknos, T N; Kumar, P. A muscle-specific protein 'myoferlin' modulates IL-6/STAT3 signaling by chaperoning activated STAT3 to nucleus. Oncogene. 2017;36(46):6374-6382.  PubMed
Barnhouse, Victoria R; Weist, Jessica L; Shukla, Vasudha C; Ghadiali, Samir N; Kniss, Douglas A; Leight, Jennifer L. Myoferlin regulates epithelial cancer cell plasticity and migration through autocrine TGF-β1 signaling. Oncotarget. 2018;9(27):19209-19222.  PubMed
Rademaker, Gilles; Costanza, Brunella; Anania, Sandy; Agirman, Ferman; Maloujahmoum, Naïma; Di Valentin, Emmanuel; Goval, Jean Jacques; Bellahcène, Akeila; Castronovo, Vincenzo; Peulen, Olivier. Myoferlin Contributes to the Metastatic Phenotype of Pancreatic Cancer Cells by Enhancing Their Migratory Capacity through the Control of Oxidative Phosphorylation. Cancers. 2019;11(6)  PubMed
Lindgren, David; Boström, Anna-Karin; Nilsson, Kristina; Hansson, Jennifer; Sjölund, Jonas; Möller, Christina; Jirström, Karin; Nilsson, Elise; Landberg, Göran; Axelson, Håkan; Johansson, Martin E. Isolation and characterization of progenitor-like cells from human renal proximal tubules. The American Journal Of Pathology. 2011;178(2):828-37.  PubMed
Volakis, Leonithas I; Li, Ruth; Ackerman, William E 4th; Mihai, Cosmin; Bechel, Meagan; Summerfield, Taryn L; Ahn, Christopher S; Powell, Heather M; Zielinski, Rachel; Rosol, Thomas J; Ghadiali, Samir N; Kniss, Douglas A. Loss of myoferlin redirects breast cancer cell motility towards collective migration. Plos One. 9(2):e86110.  PubMed
Bhattacharyya, Sohinee; Rainey, Mark A; Arya, Priyanka; Mohapatra, Bhopal C; Mushtaq, Insha; Dutta, Samikshan; George, Manju; Storck, Matthew D; McComb, Rodney D; Muirhead, David; Todd, Gordon L; Gould, Karen; Datta, Kaustubh; Gelineau-van Waes, Janee; Band, Vimla; Band, Hamid. Endocytic recycling protein EHD1 regulates primary cilia morphogenesis and SHH signaling during neural tube development. Scientific Reports. 2016;6( 26884322):20727.  PubMed
Rademaker, Gilles; Hennequière, Vincent; Brohée, Laura; Nokin, Marie-Julie; Lovinfosse, Pierre; Durieux, Florence; Gofflot, Stéphanie; Bellier, Justine; Costanza, Brunella; Herfs, Michael; Peiffer, Raphael; Bettendorff, Lucien; Deroanne, Christophe; Thiry, Marc; Delvenne, Philippe; Hustinx, Roland; Bellahcène, Akeila; Castronovo, Vincent; Peulen, Olivier. Myoferlin controls mitochondrial structure and activity in pancreatic ductal adenocarcinoma, and affects tumor aggressiveness. Oncogene. 2018;37(32):4398-4412.  PubMed
Rademaker, Gilles; Costanza, Brunella; Bellier, Justine; Herfs, Michael; Peiffer, Raphaël; Agirman, Ferman; Maloujahmoum, Naïma; Habraken, Yvette; Delvenne, Philippe; Bellahcène, Akeila; Castronovo, Vincent; Peulen, Olivier. Human colon cancer cells highly express myoferlin to maintain a fit mitochondrial network and escape p53-driven apoptosis. Oncogenesis. 2019;8(3):21.  PubMed
Anania, Sandy; Peiffer, Raphaël; Rademaker, Gilles; Hego, Alexandre; Thiry, Marc; Deldicque, Louise; Francaux, Marc; Maloujahmoum, Naïma; Agirman, Ferman; Bellahcène, Akeila; Castronovo, Vincent; Peulen, Olivier. Myoferlin Is a Yet Unknown Interactor of the Mitochondrial Dynamics' Machinery in Pancreas Cancer Cells. Cancers. 2020;12(6)  PubMed
Gupta, Suprit; Yano, Julian; Mercier, Vincent; Htwe, Htet Htwe; Shin, Hijai R; Rademaker, Gilles; Cakir, Zeynep; Ituarte, Thomas; Wen, Kwun W; Kim, Grace E; Zoncu, Roberto; Roux, Aurélien; Dawson, David W; Perera, Rushika M. Lysosomal retargeting of Myoferlin mitigates membrane stress to enable pancreatic cancer growth. Nature Cell Biology. 2021;23(3):232-242.  PubMed
Shi, Hailong; Cheng, Yuanyuan; Shi, Qimei; Liu, Wenzhi; Yang, Xue; Wang, Shuang; Wei, Lin; Chen, Xiangming; Fang, Hao. Myoferlin disturbs redox equilibrium to accelerate gastric cancer migration. Frontiers In Oncology. 12( 36147922):905230.  PubMed
Polakowski, Nicholas; Sarker, Md Abu Kawsar; Hoang, Kimson; Boateng, Georgina; Rushing, Amanda W; Kendle, Wesley; Pique, Claudine; Green, Patrick L; Panfil, Amanda R; Lemasson, Isabelle. HBZ upregulates myoferlin expression to facilitate HTLV-1 infection. Plos Pathogens. 2023;19(2):e1011202.  PubMed