Anti MYO3B pAb (ATL-HPA045483)

Atlas Antibodies

Catalog No.:
ATL-HPA045483-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: myosin IIIB
Gene Name: MYO3B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042064: 88%, ENSRNOG00000030022: 90%
Entrez Gene ID: 140469
Uniprot ID: Q8WXR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FISQCLIKDFERRPSVTHLLDHPFIKGVHGKVLFLQKQLAKVLQDQKHQNPVAKTRHERMHTRRPYHVEDAEKYCLEDDLVNLEVLDEDTIIHQLQKRYADLLIY
Gene Sequence FISQCLIKDFERRPSVTHLLDHPFIKGVHGKVLFLQKQLAKVLQDQKHQNPVAKTRHERMHTRRPYHVEDAEKYCLEDDLVNLEVLDEDTIIHQLQKRYADLLIY
Gene ID - Mouse ENSMUSG00000042064
Gene ID - Rat ENSRNOG00000030022
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MYO3B pAb (ATL-HPA045483)
Datasheet Anti MYO3B pAb (ATL-HPA045483) Datasheet (External Link)
Vendor Page Anti MYO3B pAb (ATL-HPA045483) at Atlas Antibodies

Documents & Links for Anti MYO3B pAb (ATL-HPA045483)
Datasheet Anti MYO3B pAb (ATL-HPA045483) Datasheet (External Link)
Vendor Page Anti MYO3B pAb (ATL-HPA045483)