Anti MYO1F pAb (ATL-HPA055242 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055242-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MYO1F
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024300: 73%, ENSRNOG00000008409: 72%
Entrez Gene ID: 4542
Uniprot ID: O00160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RTLTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPPRGMDRNGVPPSARGGPLPLEIMSGG |
Gene Sequence | RTLTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPPRGMDRNGVPPSARGGPLPLEIMSGG |
Gene ID - Mouse | ENSMUSG00000024300 |
Gene ID - Rat | ENSRNOG00000008409 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MYO1F pAb (ATL-HPA055242 w/enhanced validation) | |
Datasheet | Anti MYO1F pAb (ATL-HPA055242 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MYO1F pAb (ATL-HPA055242 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti MYO1F pAb (ATL-HPA055242 w/enhanced validation) | |
Datasheet | Anti MYO1F pAb (ATL-HPA055242 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MYO1F pAb (ATL-HPA055242 w/enhanced validation) |
Citations for Anti MYO1F pAb (ATL-HPA055242 w/enhanced validation) – 1 Found |
Piedra-Quintero, Zayda L; Serrano, Carolina; Villegas-Sepúlveda, Nicolás; Maravillas-Montero, José L; Romero-Ramírez, Sandra; Shibayama, Mineko; Medina-Contreras, Oscar; Nava, Porfirio; Santos-Argumedo, Leopoldo. Myosin 1F Regulates M1-Polarization by Stimulating Intercellular Adhesion in Macrophages. Frontiers In Immunology. 9( 30687322):3118. PubMed |