Anti MYO18B pAb (ATL-HPA000953)

Atlas Antibodies

Catalog No.: ATL-HPA000953-25

Protein Description: myosin XVIIIB
Gene Name: MYO18B
Alternative Gene Name: BK125H2.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072720: 71%, ENSRNOG00000048430: 69%
Entrez Gene ID: 84700
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSDPFSWKLPSLDYERKTKVDFDDFLPAIRKPQTPTSLAGSAKGGQDGSQRSSIHFETEEANRSFLSGIKTILKKSPEPKEDPAHLSDSSSSSGSIVSFKSADSIKSRPGIPRLAGDGGERTSPERREPGTGRKDDDVASIMKKY
• Gene Sequence: GSDPFSWKLPSLDYERKTKVDFDDFLPAIRKPQTPTSLAGSAKGGQDGSQRSSIHFETEEANRSFLSGIKTILKKSPEPKEDPAHLSDSSSSSGSIVSFKSADSIKSRPGIPRLAGDGGERTSPERREPGTGRKDDDVASIMKKY
• Gene ID - Mouse: ENSMUSG00000072720
• Gene ID - Rat: ENSRNOG00000048430
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MYO18B pAb (ATL-HPA000953) – 1 Found

Jiu, Yaming; Kumari, Reena; Fenix, Aidan M; Schaible, Niccole; Liu, Xiaonan; Varjosalo, Markku; Krishnan, Ramaswamy; Burnette, Dylan T; Lappalainen, Pekka. Myosin-18B Promotes the Assembly of Myosin II Stacks for Maturation of Contractile Actomyosin Bundles. Current Biology : Cb. 2019;29(1):81-92.e5.