Anti MYNN pAb (ATL-HPA045149)

Atlas Antibodies

SKU:
ATL-HPA045149-25
  • Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: myoneurin
Gene Name: MYNN
Alternative Gene Name: SBBIZ1, ZBTB31, ZNF902
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037730: 78%, ENSRNOG00000027923: 77%
Entrez Gene ID: 55892
Uniprot ID: Q9NPC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FNSPKTGQNKTVQYPSDILENASVELFLDANKLPTPVVEQVAQINDNSELELTSVVENTFPAQDIVHTVTVKRKRGKSQPNCALKEHSMSNIASVKSPYEAENSGEELDQRY
Gene Sequence FNSPKTGQNKTVQYPSDILENASVELFLDANKLPTPVVEQVAQINDNSELELTSVVENTFPAQDIVHTVTVKRKRGKSQPNCALKEHSMSNIASVKSPYEAENSGEELDQRY
Gene ID - Mouse ENSMUSG00000037730
Gene ID - Rat ENSRNOG00000027923
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MYNN pAb (ATL-HPA045149)
Datasheet Anti MYNN pAb (ATL-HPA045149) Datasheet (External Link)
Vendor Page Anti MYNN pAb (ATL-HPA045149) at Atlas Antibodies

Documents & Links for Anti MYNN pAb (ATL-HPA045149)
Datasheet Anti MYNN pAb (ATL-HPA045149) Datasheet (External Link)
Vendor Page Anti MYNN pAb (ATL-HPA045149)