Anti MYLK4 pAb (ATL-HPA015860)

Atlas Antibodies

Catalog No.:
ATL-HPA015860-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: myosin light chain kinase family, member 4
Gene Name: MYLK4
Alternative Gene Name: SgK085
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044951: 87%, ENSRNOG00000050349: 83%
Entrez Gene ID: 340156
Uniprot ID: Q86YV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGLSPFLGDNDAETLNNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRISASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDFV
Gene Sequence SGLSPFLGDNDAETLNNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRISASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDFV
Gene ID - Mouse ENSMUSG00000044951
Gene ID - Rat ENSRNOG00000050349
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MYLK4 pAb (ATL-HPA015860)
Datasheet Anti MYLK4 pAb (ATL-HPA015860) Datasheet (External Link)
Vendor Page Anti MYLK4 pAb (ATL-HPA015860) at Atlas Antibodies

Documents & Links for Anti MYLK4 pAb (ATL-HPA015860)
Datasheet Anti MYLK4 pAb (ATL-HPA015860) Datasheet (External Link)
Vendor Page Anti MYLK4 pAb (ATL-HPA015860)